DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and IRC24

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_012302.3 Gene:IRC24 / 854854 SGDID:S000001475 Length:263 Species:Saccharomyces cerevisiae


Alignment Length:256 Identity:79/256 - (30%)
Similarity:122/256 - (47%) Gaps:51/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIV-----AAGGAPALQ------ 60
            |||::||||.|||    :.|.|     |::       .|..|.||     ...|..:||      
Yeast     3 KVILITGASRGIG----LQLVK-----TVI-------EEDDECIVYGVARTEAGLQSLQREYGAD 51

  Fly    61 ----VAADINSESDVQGIVSATLAKHGRIDVLVNNAGILE-LGSIENTS----LEQFDRVMNTNV 116
                ...||...|.::.:|.....|||::|.:|.|||:|| :.||..::    ::|::|:.:.|.
Yeast    52 KFVYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNF 116

  Fly   117 RSLYQLTHLVTPELIKTK---GNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGV 178
            .|:..|..|..| |:|:.   ||||.|||...::.:.|..||..||||::.|...:|.|.....|
Yeast   117 FSIVSLVALCLP-LLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKV 180

  Fly   179 RVNSVNPGVIITELQR-------RGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFL 232
            |...:.|||:.|::|:       ..|:..:|..:|.:..|.:..|    :.|..||.:|.|
Yeast   181 RAVCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLL----DPKVPAAVLAQL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 79/256 (31%)
NADB_Rossmann 4..254 CDD:304358 79/256 (31%)
IRC24NP_012302.3 SPR-like_SDR_c 4..255 CDD:187625 78/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341272
Domainoid 1 1.000 86 1.000 Domainoid score I1866
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I1506
Isobase 1 0.950 - 0 Normalized mean entropy S2936
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.