DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and CBR4

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_006714454.1 Gene:CBR4 / 84869 HGNCID:25891 Length:247 Species:Homo sapiens


Alignment Length:257 Identity:88/257 - (34%)
Similarity:124/257 - (48%) Gaps:28/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESD 70
            |||..|.|.|.|||...:.|:|:.|..|.::.|||:.....|..:    |...|..:.|:..|.|
Human     2 DKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDL----GGDHLAFSCDVAKEHD 62

  Fly    71 VQGIVSATLAKH-GRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKTK 134
            ||.... .|.|| ||::.|||.|||...|.:..|..|.....::||:.............:|:.:
Human    63 VQNTFE-ELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQ 126

  Fly   135 -GNIVNVS----------SVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVI 188
             |:||||.          |:.|::...|...|:.||..:..|:|.:|.|:|.|.:|||.|.||.:
Human   127 GGSIVNVGHRREMLLHKRSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFV 191

  Fly   189 ITELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            .|::.:    |.:.     ||.|....|||.||..|||.|:.||.  |:.:.||..|.||||
Human   192 HTDMTK----DLKE-----EHLKKNIPLGRFGETIEVAHAVVFLL--ESPYITGHVLVVDGG 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 88/257 (34%)
NADB_Rossmann 4..254 CDD:304358 88/257 (34%)
CBR4XP_006714454.1 NADB_Rossmann 3..243 CDD:304358 87/256 (34%)
3oxo_ACP_reduc 7..243 CDD:273824 85/252 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.