DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and AT1G63380

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001319302.1 Gene:AT1G63380 / 842644 AraportID:AT1G63380 Length:287 Species:Arabidopsis thaliana


Alignment Length:264 Identity:90/264 - (34%)
Similarity:146/264 - (55%) Gaps:31/264 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAG--GAPALQVAADINS 67
            ||||::|||||||||....:.|.|.|..:....|.:|:||....:|.:.|  |..|:.:..|::|
plant    23 KDKVVLVTGASSGIGREICLDLCKAGCKIVAAARRVDRLNSLCSEINSFGAIGVQAVALELDVSS 87

  Fly    68 ESD-VQGIVSATLAKHGRIDVLVNNAGILELGSIENT---SLEQFDRVMNTNVRSLYQLTHLVTP 128
            |:| ::..|.......|:||||:|||||  .|:::::   |.|::|:|..||:...:.::..|..
plant    88 EADTIRKAVKEAWETFGKIDVLINNAGI--RGNVKSSLDLSEEEWDKVFRTNLTGSWLISKYVCL 150

  Fly   129 EL--IKTKGNIVNVSSVNGIRS--FPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVII 189
            .:  .:..|:::||||::|:..  ..|.|||..||..||..||.:|:|||...:||||:.||:..
plant   151 LMRDAERGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIELAVYKIRVNSIAPGIFR 215

  Fly   190 TELQRRGGLDQEAYVKFLEHAKVTHAL--------GRPGEVKEVAAAIAFLASDEASFSTGISLP 246
            :|:.:  ||.|:.::|     |||..:        ..||    :.:.:.:|..|.:.:.||.:..
plant   216 SEITQ--GLFQKEWLK-----KVTEKVVPLKMQQTVDPG----LTSLVRYLIHDSSQYVTGNTYI 269

  Fly   247 VDGG 250
            ||.|
plant   270 VDSG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 90/264 (34%)
NADB_Rossmann 4..254 CDD:304358 90/264 (34%)
AT1G63380NP_001319302.1 fabG 22..276 CDD:235546 90/264 (34%)
SDR_c 27..271 CDD:212491 83/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.