DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and AT1G62610

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001185294.1 Gene:AT1G62610 / 842558 AraportID:AT1G62610 Length:282 Species:Arabidopsis thaliana


Alignment Length:264 Identity:89/264 - (33%)
Similarity:144/264 - (54%) Gaps:31/264 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAG--GAPALQVAADINS 67
            ||||::|||||||||....:.|.|.|..:....|.:|:||....:|.:.|  |..|..:..|::|
plant    20 KDKVVLVTGASSGIGREICLDLCKAGCKIVAAARRVDRLNSLCSEINSFGAIGVQAAALELDVSS 84

  Fly    68 ESD-VQGIVSATLAKHGRIDVLVNNAGILELGSIENT---SLEQFDRVMNTNVRSLYQLTHLVTP 128
            ::| ::..|.......|.||||:|||||  .|:::::   |.|::|:|..||:...:.::..|..
plant    85 DADTIRKAVKEAWEIFGTIDVLINNAGI--RGNVKSSLDLSKEEWDKVFRTNLTGSWLISKYVCL 147

  Fly   129 EL--IKTKGNIVNVSSVNGIRS--FPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVII 189
            .:  .|..|:::||||::|:..  ..|.|||..||..||..||.:|:|||...:||||:.||:..
plant   148 LMRDAKRGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIELAVYKIRVNSIAPGIFR 212

  Fly   190 TELQRRGGLDQEAYVKFLEHAKVTHAL--------GRPGEVKEVAAAIAFLASDEASFSTGISLP 246
            :|:.:  ||.|:.:::     |||..:        ..||    :.:.:.:|..|.:.:.||.:..
plant   213 SEITQ--GLFQKEWLE-----KVTEKIVPLKMQQTVDPG----LTSLVRYLIHDSSQYVTGNTYI 266

  Fly   247 VDGG 250
            ||.|
plant   267 VDSG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 89/264 (34%)
NADB_Rossmann 4..254 CDD:304358 89/264 (34%)
AT1G62610NP_001185294.1 fabG 19..273 CDD:235546 89/264 (34%)
SDR_c 24..268 CDD:212491 82/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1153
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.