DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and AT1G07450

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_172225.1 Gene:AT1G07450 / 837257 AraportID:AT1G07450 Length:260 Species:Arabidopsis thaliana


Alignment Length:262 Identity:85/262 - (32%)
Similarity:130/262 - (49%) Gaps:32/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVA---AD 64
            |.:....:|||.|.|||......|...|..:.|...:...|||    .::...|...:|:   .|
plant     7 SLQGMTALVTGGSKGIGYAIVEELVGFGARVHICDIDETLLNE----CLSGWHAKGFEVSGSICD 67

  Fly    65 INSESD-VQGIVSATLAKHGRIDVLVNNAG--ILELGSIENTSLEQFDRVMNTNVRSLYQLTHLV 126
            ::|... ||.:.:.:.....::::|:||.|  ||: .::|:|: |.|..:|.||:.|.|.::.|.
plant    68 VSSRPQRVQLMQTVSSLFGAKLNILINNVGKYILK-PTLESTA-EDFSSLMATNLESAYYISQLA 130

  Fly   127 TPELIKT--KGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVII 189
            .| |:|.  .||||.:|||.|:.|....: |.|:|.|::|..|.:|.|.|...:|.|||.|.|..
plant   131 HP-LLKASGNGNIVFISSVTGVVSGTSTI-YGVTKGALNQLARDLACEWASDNIRANSVAPWVTA 193

  Fly   190 TELQRRGGLDQEAYVKFLEHAKVTHA------LGRPGEVKEVAAAIAFLASDEASFSTGISLPVD 248
            |.|.:          |:||......|      |||..|.:|||:.:.||....||:.||.::.:|
plant   194 TSLVQ----------KYLEDEIFAEAMFSRTPLGRACEPREVASLVTFLCLPAASYITGQTICID 248

  Fly   249 GG 250
            ||
plant   249 GG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 85/262 (32%)
NADB_Rossmann 4..254 CDD:304358 84/261 (32%)
AT1G07450NP_172225.1 PRK09242 5..256 CDD:181721 85/262 (32%)
NADB_Rossmann 5..254 CDD:304358 85/262 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 1 0.900 - - OOG6_101836
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.