DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and AT1G07440

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_172224.1 Gene:AT1G07440 / 837256 AraportID:AT1G07440 Length:266 Species:Arabidopsis thaliana


Alignment Length:256 Identity:83/256 - (32%)
Similarity:127/256 - (49%) Gaps:20/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINS 67
            |.|.|.::|||.:.|||.......|..|.::....||..:|||...:....|    .||...:..
plant    11 SLKAKTVLVTGGTKGIGHAIVEEFAGFGAVIHTCARNEYELNECLSKWQKKG----FQVTGSVCD 71

  Fly    68 ES------DVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLV 126
            .|      .:...||:...  |::|:|:||.|.:......:.:.|.|...::||:.|.|.|:.|.
plant    72 ASLRPEREKLMQTVSSMFG--GKLDILINNLGAIRSKPTLDYTAEDFSFHISTNLESAYHLSQLA 134

  Fly   127 TPELIKTK--GNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVII 189
            .| |:|..  |||:.:||:.|:.|......|:.:|.|::|..|.:|.|.|..|:|.|:|.|.||.
plant   135 HP-LLKASGCGNIIFMSSIAGVVSASVGSIYSATKGALNQLARNLACEWASDGIRANAVAPAVIA 198

  Fly   190 TELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            |.|..  .:..:.:.|.:...|   .|||.||.:||::.:|||....||:.||.::.||||
plant   199 TPLAE--AVYDDEFKKVVISRK---PLGRFGEPEEVSSLVAFLCMPAASYITGQTICVDGG 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 83/256 (32%)
NADB_Rossmann 4..254 CDD:304358 82/255 (32%)
AT1G07440NP_172224.1 TR_SDR_c 9..258 CDD:187590 83/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 1 0.900 - - OOG6_101836
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.