DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and AT5G18210

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_197322.2 Gene:AT5G18210 / 831939 AraportID:AT5G18210 Length:277 Species:Arabidopsis thaliana


Alignment Length:249 Identity:84/249 - (33%)
Similarity:126/249 - (50%) Gaps:28/249 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVA-----AGGAP---AL 59
            |...:|.||||:|.|||...::.||:||..:.|   |....:..|:|:.|     ||..|   |:
plant     7 SLAGRVAIVTGSSRGIGRAIAIHLAELGAKIVI---NYTTRSTEADQVAAEINSSAGTVPQPIAV 68

  Fly    60 QVAADINSESDVQGIV-SATLAKHGRIDVLVNNAGIL--ELGSIENTSLEQFDRVMNTNVRSLYQ 121
            ...|||:..|.::.:. :|..|.:..:.:|||:||||  ...:|.||.:|:|||:...|.|..: 
plant    69 VFLADISEPSQIKSLFDAAEKAFNSPVHILVNSAGILNPNYPTIANTPIEEFDRIFKVNTRGSF- 132

  Fly   122 LTHLVTPELIKT-----KGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVN 181
               |...|..|.     .|.|:.::|.......||..||..|||||:...:.:|.||...|:..|
plant   133 ---LCCKEAAKRLKRGGGGRIILLTSSLTEALIPGQGAYTASKAAVEAMVKILAKELKGLGITAN 194

  Fly   182 SVNPGVIITELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASD 235
            .|:||.:.||: ...|..:|..:..:|.:    ..||.||.|::|:.:.|||||
plant   195 CVSPGPVATEM-FFDGKSEETVMNIIERS----PFGRLGETKDIASVVGFLASD 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 84/249 (34%)
NADB_Rossmann 4..254 CDD:304358 83/248 (33%)
AT5G18210NP_197322.2 fabG 7..245 CDD:235500 84/249 (34%)
NADB_Rossmann 8..245 CDD:304358 83/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.