DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and AT4G03140

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_567251.2 Gene:AT4G03140 / 828065 AraportID:AT4G03140 Length:343 Species:Arabidopsis thaliana


Alignment Length:259 Identity:80/259 - (30%)
Similarity:124/259 - (47%) Gaps:27/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTI------VGRNLDKLNETAEQIVAAGGAPALQVAADI 65
            ||.::||.:||||..|:......|..:.|      :||      ||.:::    |........|:
plant    81 KVALITGGASGIGKATAGKFISHGAKVIIADIQPQIGR------ETEQEL----GPSCAYFPCDV 135

  Fly    66 NSESDVQGIVSATLAKHGRIDVLVNNAGI--LELGSIENTSLEQFDRVMNTNVRSLYQ-LTHLVT 127
            ..|||:...|...::.|.::|::.|||||  ....||.:..|..||:|:|||||.:.. :.|...
plant   136 TKESDIANAVDFAVSLHTKLDIMYNNAGIPCKTPPSIVDLDLNVFDKVINTNVRGVMAGIKHAAR 200

  Fly   128 PELIKTKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITEL 192
            ..:.:..|:|:...||.|:........|:|||:||....|..|.||....:|||.::|..|.|..
plant   201 VMIPRNSGSIICAGSVTGMMGGLAQHTYSVSKSAVIGIVRSTASELCKHRIRVNCISPFAITTSF 265

  Fly   193 ------QRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
                  |...|:|....::.::...|.:  |...|..:||.|..:||||::.:..|.:|.||||
plant   266 VMDEMRQIYPGVDDSRLIQIVQSTGVLN--GEVCEPTDVANAAVYLASDDSKYVNGHNLVVDGG 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 80/259 (31%)
NADB_Rossmann 4..254 CDD:304358 80/259 (31%)
AT4G03140NP_567251.2 PLN02253 77..331 CDD:177895 80/259 (31%)
NADB_Rossmann 77..329 CDD:304358 80/259 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.