DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and AT4G13180

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_193054.1 Gene:AT4G13180 / 826932 AraportID:AT4G13180 Length:263 Species:Arabidopsis thaliana


Alignment Length:255 Identity:75/255 - (29%)
Similarity:121/255 - (47%) Gaps:21/255 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIV-----AAGGAPALQVAADIN 66
            :|.|||||:.|:|...::.|..||..:||   |....:..||.:|     ::....|:.|.||::
plant    16 RVAIVTGATRGMGREIAIHLHSLGARVTI---NYVSSSSKAELLVSELNDSSQLKSAIAVKADVS 77

  Fly    67 SESDVQGIVSATLAKHG-RIDVLVNNAGILE--LGSIENTSLEQFDRVMNTNVRSLYQLTHLVTP 128
            ....:..:...|..:.| ::.::||.||:|:  ..|:..|:||.||.....|.|..:........
plant    78 DPDQINNLFDQTEQEFGSKVHIVVNCAGVLDPKYPSLSETTLEDFDNTFTINTRGSFLCCKEAAK 142

  Fly   129 ELIKTKGN---IVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIIT 190
            .:::..|.   :::.|.|.|:.  ||...|..|||||:...:.:|.||....:..|.|.||.:.|
plant   143 RVMRGGGGRIIMMSTSMVGGLA--PGYGVYAASKAAVETMVKVLAKELKGSRITANCVAPGPVAT 205

  Fly   191 ELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            |:...|..|:.  ||.|..|   ..:||.||.|::...:.|||.|...:..|..:..:||
plant   206 EMFYAGKSDET--VKMLAGA---CPMGRIGESKDITEIVGFLAGDGGEWINGQVIRANGG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 75/255 (29%)
NADB_Rossmann 4..254 CDD:304358 75/255 (29%)
AT4G13180NP_193054.1 THN_reductase-like_SDR_c 13..262 CDD:187620 75/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.