DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and AT3G55310

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_191091.2 Gene:AT3G55310 / 824697 AraportID:AT3G55310 Length:279 Species:Arabidopsis thaliana


Alignment Length:260 Identity:86/260 - (33%)
Similarity:145/260 - (55%) Gaps:24/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQI--VAAGGAPALQVAADINS 67
            ||||::|||||||||....:.|||.|..:....|.:|:||....:|  .::.|..|..:..|::|
plant    18 KDKVVLVTGASSGIGREICLDLAKAGCQVIAAARRVDRLNSLCSEINSFSSTGIQAAALELDVSS 82

  Fly    68 E-SDVQGIVSATLAKHGRIDVLVNNAGILELGSIE---NTSLEQFDRVMNTNVRSLYQLTHLVTP 128
            : :.:|..|.......|:||.|:|||||  .|:::   :.|.:::|.|.|||::..:.:...|..
plant    83 DAATIQKAVREAWDIFGKIDALINNAGI--RGNVKLSLDLSEDEWDNVFNTNLKGPWLVAKYVCV 145

  Fly   129 EL--IKTKGNIVNVSSVNGIRSF-PGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIIT 190
            .:  .|..|:::|:|||.|:||. ||.|||:.||..||..:|.:|:||....:||||:.||:..:
plant   146 LMRDAKRGGSVINISSVAGVRSIVPGGLAYSCSKGGVDTMSRMMAIELGVHKIRVNSIAPGLFKS 210

  Fly   191 ELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKE-----VAAAIAFLASDEASFSTGISLPVDGG 250
            |:.:  .|.|:.::|.:....|      |.:|::     :.:.:.:|..|.:.:.:|.:..||.|
plant   211 EITQ--ALMQKEWLKNVTERTV------PLKVQQTIDPGLTSLVRYLIHDSSQYISGNTYIVDSG 267

  Fly   251  250
            plant   268  267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 86/260 (33%)
NADB_Rossmann 4..254 CDD:304358 86/260 (33%)
AT3G55310NP_191091.2 SDR_c 22..265 CDD:212491 79/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1153
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.