DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and SDR2

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_190736.1 Gene:SDR2 / 824331 AraportID:AT3G51680 Length:303 Species:Arabidopsis thaliana


Alignment Length:266 Identity:86/266 - (32%)
Similarity:142/266 - (53%) Gaps:29/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKL--NETAEQIVAAGGAPALQ-VAADINSE 68
            ||.|:||.:.|||..|.:|.|:.|.  |:|..::|.:  :..|:.:.:...:|.:. ::.|::.|
plant    35 KVAIITGGAHGIGKATVMLFARHGA--TVVIADVDNVAGSSLAKSLSSHKTSPMVAFISCDVSVE 97

  Fly    69 SDVQGIVSATLAKHGRIDVLVNNAGIL----ELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPE 129
            :||:.:|:.|:|::||:|:|.||||:|    :..||.:...::||.||..|||.:..........
plant    98 ADVENLVNVTVARYGRLDILFNNAGVLGDQKKHKSILDFDADEFDHVMRVNVRGVGLGMKHGARA 162

  Fly   130 LIKT--KGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITEL 192
            :||.  ||.|::.:||.|:....|..||..||.|:...|:..|.||...|:|||.::|..:.|.:
plant   163 MIKRGFKGCIISTASVAGVMGGMGPHAYTASKHAIVGLTKNAACELGKYGIRVNCISPFGVATSM 227

  Fly   193 ------QRRGG-------LDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGIS 244
                  :..||       .:.|.:|:.|.:.|     |......::|.|..:|||||:.:..|.:
plant   228 LVNAWRKTSGGDVEDDDVEEMEEFVRSLANLK-----GETLRANDIAEAALYLASDESKYVNGHN 287

  Fly   245 LPVDGG 250
            |.||||
plant   288 LVVDGG 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 86/266 (32%)
NADB_Rossmann 4..254 CDD:304358 86/266 (32%)
SDR2NP_190736.1 PLN02253 23..296 CDD:177895 86/266 (32%)
NADB_Rossmann 31..295 CDD:304358 86/266 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1924
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.