DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and AT3G04000

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_566221.2 Gene:AT3G04000 / 819555 AraportID:AT3G04000 Length:272 Species:Arabidopsis thaliana


Alignment Length:263 Identity:79/263 - (30%)
Similarity:126/263 - (47%) Gaps:29/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIV------------AAGGAP-A 58
            :|.||||:|.|||...::.||:||..:.:   |.......||::.            .||.:| .
plant    17 RVAIVTGSSRGIGRAIAIHLAELGARVVV---NYSTSPVEAEKVATAITTNCSKDAEVAGKSPRV 78

  Fly    59 LQVAADINSESDVQGIV-SATLAKHGRIDVLVNNAGILE--LGSIENTSLEQFDRVMNTNVRSLY 120
            :.|.|||:..|.|:.:. .|.......:.:|||:|.|.:  ..:|.:.|:|.|||:::.|.|..:
plant    79 IVVKADISEPSQVKSLFDEAERVFESPVHILVNSAAIADPNHSTISDMSVELFDRIISVNTRGAF 143

  Fly   121 QLTHLVTPELIKTKGN---IVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNS 182
            .........|.:..|.   :::.|.|..:.:..|  :|..|||||:...:.:|.||....:.||.
plant   144 ICAREAANRLKRGGGGRIILLSTSLVQTLNTNYG--SYTASKAAVEAMAKILAKELKGTEITVNC 206

  Fly   183 VNPGVIITELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPV 247
            |:||.:.||:... ||..|    .:|..|..:..||.||.|::|..:.|||||...:..|..:..
plant   207 VSPGPVATEMFYT-GLSNE----IVEKVKSQNLFGRIGETKDIAPVVGFLASDAGEWINGQVIMA 266

  Fly   248 DGG 250
            :||
plant   267 NGG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 79/263 (30%)
NADB_Rossmann 4..254 CDD:304358 79/263 (30%)
AT3G04000NP_566221.2 SDR 14..269 CDD:330230 77/261 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.