DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and AT3G03980

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_187048.1 Gene:AT3G03980 / 819553 AraportID:AT3G03980 Length:270 Species:Arabidopsis thaliana


Alignment Length:257 Identity:79/257 - (30%)
Similarity:125/257 - (48%) Gaps:18/257 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTI--------VGRNLDKLNE-TAEQIVAAGGAPALQVA 62
            :|.||||:|.|||...::.||:||..:.|        ..|...::|: ...:.:...|..|:.|.
plant    17 RVAIVTGSSRGIGRAIAIHLAELGARIVINYTSKAADAERVASEINDFPVREEITGKGPRAIVVQ 81

  Fly    63 ADINSESDVQGIV-SATLAKHGRIDVLVNNAGILE--LGSIENTSLEQFDRVMNTNVRSLYQLTH 124
            |:::..|.|:.:. :|..|....:.:|||:||||:  ..:|.:||:|.||...:.|.:..:..:.
plant    82 ANVSEPSQVKSMFDAAESAFEAPVHILVNSAGILDPKYPTIADTSVEDFDHTFSVNTKGAFLCSK 146

  Fly   125 LVTPELIKTKGNIVNVSSVNGIRSF-PGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVI 188
            .....|.:..|..:.:.:.:..||. ||..||..|||||:...:.:|.||...|:..|.|.||.|
plant   147 EAANRLKQGGGGRIILLTSSQTRSLKPGFGAYAASKAAVETMVKILAKELKGTGITANCVAPGPI 211

  Fly   189 ITELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            .||:...|...:     .:|........||.||.|:|...:.|||.|...:..|..:||:||
plant   212 ATEMFFDGKTPE-----LVEKIAAESPFGRVGEAKDVVPLVGFLAGDGGEWVNGQIIPVNGG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 79/257 (31%)
NADB_Rossmann 4..254 CDD:304358 79/257 (31%)
AT3G03980NP_187048.1 THN_reductase-like_SDR_c 14..270 CDD:187620 79/257 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.