DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and SDR3

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_182235.1 Gene:SDR3 / 819326 AraportID:AT2G47130 Length:257 Species:Arabidopsis thaliana


Alignment Length:255 Identity:87/255 - (34%)
Similarity:130/255 - (50%) Gaps:12/255 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQI-VAAGGAPALQVAADINSESD 70
            |:.|:||.:|||||....|....|..:.||    |...|..:.: |:.|...|.....|:.:|.:
plant     9 KIAIITGGASGIGAEAVRLFTDHGAKVVIV----DFQEELGQNVAVSVGKDKASFYRCDVTNEKE 69

  Fly    71 VQGIVSATLAKHGRIDVLVNNAGILEL-GSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK-- 132
            |:..|..|:.|:|::|||.:|||::|. ||..:.:||||||.|..|||............:::  
plant    70 VENAVKFTVEKYGKLDVLFSNAGVMEQPGSFLDLNLEQFDRTMAVNVRGAAAFIKHAARAMVEKG 134

  Fly   133 TKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGG 197
            |:|:||..:||......||..||..||.|:....:.....|...|:|||.|.|..:.|.:..|  
plant   135 TRGSIVCTTSVASEIGGPGPHAYTASKHALLGLVKSACGGLGKYGIRVNGVAPYAVATAINSR-- 197

  Fly   198 LDQEAYVKFLEHAKVTHAL-GRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGRHAMCP 256
             |:|......|::..|..| |...:.:.||.|..|||||::::.:|.:|.||||...:.|
plant   198 -DEETVRMVEEYSAATGILKGVVLKARHVAEAALFLASDDSAYVSGQNLAVDGGYSVVKP 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 85/248 (34%)
NADB_Rossmann 4..254 CDD:304358 86/251 (34%)
SDR3NP_182235.1 PLN02253 1..254 CDD:177895 86/251 (34%)
NADB_Rossmann 5..252 CDD:304358 86/249 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1923
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1924
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.