DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and AT2G29370

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_850132.2 Gene:AT2G29370 / 817486 AraportID:AT2G29370 Length:268 Species:Arabidopsis thaliana


Alignment Length:262 Identity:83/262 - (31%)
Similarity:126/262 - (48%) Gaps:23/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDK--------VIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPAL 59
            |.:||        ..:|||.|.|:|......||.||..:....|:..:|.|:..:..|.|    |
plant     7 SLRDKPKWSLEGMTALVTGGSKGLGKAVVEELAMLGARVHTCARDETQLQESLREWQAKG----L 67

  Fly    60 QV---AADINSESDVQGIVSATLAK-HGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLY 120
            ||   ..|::|....:.::....:. .|::.:||.|.||..|......:.|:|..::.||:.|.:
plant    68 QVTTSVCDVSSRDQREKLMETVSSLFQGKLSILVPNVGIGVLKPTTECTAEEFSFIIATNLESTF 132

  Fly   121 QLTHLVTPELIKT--KGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSV 183
            ..:.|..| |:|.  .||||.:|||.|:.:......|..:|.|::|..|.:|.|.|...:|.|||
plant   133 HFSQLAHP-LLKASGSGNIVLMSSVAGVVNLGNTSIYGATKGAMNQLARNLACEWASDNIRANSV 196

  Fly   184 NPGVIITELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVD 248
            .|..|.|...:....|::  ||  |..:....|.|.||..||::.:|||....||:.||.::.||
plant   197 CPWFITTPSTKDFLGDKD--VK--EKVESVTPLRRVGEANEVSSLVAFLCLPAASYITGQTICVD 257

  Fly   249 GG 250
            ||
plant   258 GG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 83/262 (32%)
NADB_Rossmann 4..254 CDD:304358 82/261 (31%)
AT2G29370NP_850132.2 NADB_Rossmann 13..263 CDD:389744 80/256 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 1 0.900 - - OOG6_101836
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.