DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and AT2G29310

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_180492.1 Gene:AT2G29310 / 817480 AraportID:AT2G29310 Length:262 Species:Arabidopsis thaliana


Alignment Length:264 Identity:79/264 - (29%)
Similarity:129/264 - (48%) Gaps:35/264 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLL-------TIVGRNLDKLNETAEQIVAAGGAPALQ 60
            |.:....:||||:||||......||..|.::       |::.::|.:..:...|:..:       
plant     6 SLQGMTALVTGAASGIGYAIVEELASFGAIIHICDISETLLSQSLSEWEKKGFQVSGS------- 63

  Fly    61 VAADINSESDVQGIVSATLAK-HGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLY---Q 121
             ..|:.|..|.:.::....:. .|::::||||.|::..........|.|...::||:...:   |
plant    64 -ICDVASRPDREKLMQTVSSLFDGKLNILVNNVGVIRGKPTTEYVAEDFSYHISTNLEPAFHFSQ 127

  Fly   122 LTHLVTPELIKTK--GNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVN 184
            |:||    |:|..  |:||.:||..|:.|......|:::|.|::|.||.:|.|.|..|:|.|:|.
plant   128 LSHL----LLKASGFGSIVFMSSATGVVSVQCGSIYSLTKGALNQLTRNLACEWAKDGIRANAVA 188

  Fly   185 PGVIITELQRRGGLDQEAY---VKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLP 246
            |.|:.|.|       .::|   |.|.|.......|||.||..|||:.:.||....||:.||.::.
plant   189 PNVVKTPL-------SQSYLEDVGFKEALFSRTPLGRAGEPNEVASLVVFLCLPAASYITGQTIC 246

  Fly   247 VDGG 250
            :|||
plant   247 IDGG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 79/264 (30%)
NADB_Rossmann 4..254 CDD:304358 78/263 (30%)
AT2G29310NP_180492.1 PRK09242 1..256 CDD:181721 79/264 (30%)
NADB_Rossmann 4..254 CDD:304358 79/264 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 1 0.900 - - OOG6_101836
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.