DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and AT2G29260

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_180489.1 Gene:AT2G29260 / 817475 AraportID:AT2G29260 Length:322 Species:Arabidopsis thaliana


Alignment Length:247 Identity:80/247 - (32%)
Similarity:130/247 - (52%) Gaps:15/247 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVA---ADINSESDV 71
            :|||.:.|||......||.||..:....||..:|    |..::.......:||   .|::..|..
plant    74 LVTGGTRGIGRAIVEELAGLGAEVHTCARNEYEL----ENCLSDWNRSGFRVAGSVCDVSDRSQR 134

  Fly    72 QGIV-SATLAKHGRIDVLVNNAGI-LELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKTK 134
            :.:: :.:....|::.:||||.|. :....:|.|:.| |..:|:||..|::.|..|..|.|.::|
plant   135 EALMETVSSVFEGKLHILVNNVGTNIRKPMVEFTAGE-FSTLMSTNFESVFHLCQLAYPLLRESK 198

  Fly   135 -GNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGGL 198
             |::|.:|||:|..|...:...:.:|.|::|.||.:|.|.|...:|:|:|.|..|.|.:..:...
plant   199 AGSVVFISSVSGFVSLKNMSVQSSTKGAINQLTRSLACEWAKDNIRINAVAPWYIKTSMVEQVLS 263

  Fly   199 DQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            ::|    :||.......|||.||.:||::|:|||....:|:.||..|.||||
plant   264 NKE----YLEEVYSVTPLGRLGEPREVSSAVAFLCLPASSYITGQILCVDGG 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 80/247 (32%)
NADB_Rossmann 4..254 CDD:304358 80/247 (32%)
AT2G29260NP_180489.1 NADB_Rossmann 65..315 CDD:419666 80/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.