DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and AT2G29170

DIOPT Version :10

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_180480.2 Gene:AT2G29170 / 817466 AraportID:AT2G29170 Length:107 Species:Arabidopsis thaliana


Alignment Length:85 Identity:24/85 - (28%)
Similarity:39/85 - (45%) Gaps:8/85 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINS----ESD 70
            :|||.|.|:|......||.||..:....||..:|.|...:..|.|......| .|::|    |..
plant    22 LVTGGSKGLGEAVVEELAMLGARVHTCARNETQLQECVREWQAKGFEVTTSV-CDVSSRDQREKL 85

  Fly    71 VQGIVSATLAKHGRIDVLVN 90
            ::.:.|..   .|::::||:
plant    86 MENVASIF---QGKLNILVS 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 Rossmann-fold NAD(P)(+)-binding proteins 4..254 CDD:473865 24/85 (28%)
AT2G29170NP_180480.2 Rossmann-fold NAD(P)(+)-binding proteins 13..>101 CDD:473865 22/82 (27%)

Return to query results.
Submit another query.