DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and AT2G29150

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_180479.1 Gene:AT2G29150 / 817464 AraportID:AT2G29150 Length:268 Species:Arabidopsis thaliana


Alignment Length:253 Identity:85/253 - (33%)
Similarity:130/253 - (51%) Gaps:14/253 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINS 67
            |.:....:|||.|.|:|......||.||..:....|:..:|.|...:..|.|......| .|::|
plant    15 SLEGMTALVTGGSKGLGEAVVEELAMLGARVHTCARDETQLQERLREWQAKGFEVTTSV-CDVSS 78

  Fly    68 ESDVQGIV-SATLAKHGRIDVLVNNA--GILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPE 129
            ....:.:: :.:....|::::|||||  ||:: .|.|.|: |.:..:|.||:.|.:.|:.:..| 
plant    79 REQREKLMETVSSVFQGKLNILVNNAGTGIIK-PSTEYTA-EDYSFLMATNLESAFHLSQIAHP- 140

  Fly   130 LIKT--KGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITEL 192
            |:|.  .|:||.:|||.|: ...|...|..||.|::|..|.:|.|.|...:|||||.|.||.|.|
plant   141 LLKASGSGSIVFMSSVAGL-VHTGASIYGASKGAMNQLGRSLACEWASDNIRVNSVCPWVITTPL 204

  Fly   193 QRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            ......|:    |..:..:....:||.||..||::.:|||....||:.||.::.||||
plant   205 TSFIFSDE----KLRKAVEDKTPMGRVGEANEVSSLVAFLCFPAASYITGQTICVDGG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 85/253 (34%)
NADB_Rossmann 4..254 CDD:304358 84/252 (33%)
AT2G29150NP_180479.1 PRK09242 11..264 CDD:181721 85/253 (34%)
NADB_Rossmann 13..262 CDD:304358 85/253 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 1 0.900 - - OOG6_101836
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.