DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and MOD1

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_565331.1 Gene:MOD1 / 815152 AraportID:AT2G05990 Length:390 Species:Arabidopsis thaliana


Alignment Length:211 Identity:56/211 - (26%)
Similarity:90/211 - (42%) Gaps:45/211 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 NSESDVQGIVSATLAKHGRIDVLVNNAG--------ILE------LGSIENTS------LEQFDR 110
            :|...||..........|.||:||::..        :||      |.:|..:|      |..|..
plant   187 SSNWTVQEAAECVKKDFGSIDILVHSLANGPEVSKPLLETSRKGYLAAISASSYSFVSLLRHFLP 251

  Fly   111 VMNTNVRSLYQLTHLVTPELIKTKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAP 175
            :||....|: .||::.:..:|...|        .|:.|         :|||::..||.:|.|...
plant   252 IMNPGGASI-SLTYIASERIIPGYG--------GGMSS---------AKAALESDTRVLAYEAGR 298

  Fly   176 K-GVRVNSVNPGVIITELQRR-GGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEAS 238
            | .:|||:::.|.:.:...:. |.:|     ..:|::.....:.:.....||..|.|||||..||
plant   299 KSNIRVNTISAGPLGSRAAKAIGFID-----TMIEYSYNNGPIQKTLTADEVGNAAAFLASPLAS 358

  Fly   239 FSTGISLPVDGGRHAM 254
            ..||.::.||.|.:||
plant   359 AITGATIYVDNGLNAM 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 53/206 (26%)
NADB_Rossmann 4..254 CDD:304358 54/209 (26%)
MOD1NP_565331.1 PLN02730 86..388 CDD:178331 56/211 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.