DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and MGC147226

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_012816817.1 Gene:MGC147226 / 780086 XenbaseID:XB-GENE-5822220 Length:521 Species:Xenopus tropicalis


Alignment Length:248 Identity:79/248 - (31%)
Similarity:132/248 - (53%) Gaps:9/248 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESDV 71
            :|..|||...|||...:..|.:.|..:.:|...|:|....|.:: ...|..::.:||||:.|.||
 Frog   277 RVAYVTGGGQGIGRAFAHALGEAGAKVAVVDLMLEKAEAVAFEL-QVKGIKSVAIAADISKEEDV 340

  Fly    72 QGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELI-KTKG 135
            :.||...:...||||:..|||||....:.|:|:||::|:..:.|:|.|:.........:: :..|
 Frog   341 KRIVDTIVTNWGRIDIACNNAGINMNSASEDTTLEEWDKTFSVNLRGLFMCCQAAGRVMLSQGYG 405

  Fly   136 NIVNVSSVNG-IRSFP-GVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGGL 198
            .|:|.:|:.. |...| ..||||.|||.|.:.|:.:..|...:|||||.::||::.|.|     :
 Frog   406 KIINTASMASLIVPHPQKQLAYNTSKAGVVKLTQTLGTEWIDRGVRVNCISPGIVDTPL-----I 465

  Fly   199 DQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGR 251
            ..:|....::........||..:|.::.|.:.||||:.:.:.||.:|.::||:
 Frog   466 HSDALKPLVQRWLNDIPAGRLAQVTDLQAGVVFLASEASDYMTGHNLVIEGGQ 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 78/246 (32%)
NADB_Rossmann 4..254 CDD:304358 79/248 (32%)
MGC147226XP_012816817.1 AdoMet_MTases 78..241 CDD:388410
NADB_Rossmann 269..518 CDD:389744 78/246 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.