DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and Decr1

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_080448.1 Gene:Decr1 / 67460 MGIID:1914710 Length:335 Species:Mus musculus


Alignment Length:260 Identity:68/260 - (26%)
Similarity:112/260 - (43%) Gaps:25/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINS 67
            :|:.||..:||..:|:|...:..|:.||....|..||:|.|..|||:|.:..|.....:..|:..
Mouse    56 AFQGKVAFITGGGTGLGKAMTTFLSTLGAQCVIASRNIDVLKATAEEISSKTGNKVHAIRCDVRD 120

  Fly    68 ESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK 132
            ...|...|...:...|..||::|||....:...|..:...:..:.:..:.....:|..:..:|||
Mouse   121 PDMVHNTVLELIKVAGHPDVVINNAAGNFISPSERLTPNGWKTITDIVLNGTAYVTLEIGKQLIK 185

  Fly   133 T-KG------NIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIIT 190
            . ||      ..:...|.:|.     |:..:.:|:.|:...:.:|.|....|:|.|.:.||.|.|
Mouse   186 AQKGAAFLAITTIYAESGSGF-----VMPSSSAKSGVEAMNKSLAAEWGRYGMRFNIIQPGPIKT 245

  Fly   191 E-----LQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            :     |...|..::|...:.        ..||.|.::|:|....||.||.||:..|..:..|||
Mouse   246 KGAFSRLDPTGRFEKEMIDRI--------PCGRLGTMEELANLATFLCSDYASWINGAVIRFDGG 302

  Fly   251  250
            Mouse   303  302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 68/260 (26%)
NADB_Rossmann 4..254 CDD:304358 68/259 (26%)
Decr1NP_080448.1 TER_DECR_SDR_a 57..303 CDD:187627 68/259 (26%)
PRK07677 59..303 CDD:181077 67/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.