DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and Hsd17b14

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_079606.3 Gene:Hsd17b14 / 66065 MGIID:1913315 Length:273 Species:Mus musculus


Alignment Length:261 Identity:94/261 - (36%)
Similarity:132/261 - (50%) Gaps:33/261 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIV-----AAGGAPALQ--- 60
            :..||::|||.|.||||             .||...:|    :..|:|     .|||....|   
Mouse     7 YSGKVVVVTGGSRGIGA-------------AIVRAFVD----SGAQVVFCDKDEAGGRALEQELS 54

  Fly    61 ----VAADINSESDVQGIVSATLAKHGRIDVLVNNAGILELGSI-ENTSLEQFDRVMNTNVRSLY 120
                :..|:..|.|:|.:||.||::.|.:|.:|||||......: |.||.:.|.:::..|:...|
Mouse    55 GTVFIPGDVTQERDLQTLVSETLSRFGHLDCVVNNAGYHPPAQLPEETSAQGFRQLLEVNLLGTY 119

  Fly   121 QLTHLVTPELIKTKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNP 185
            .|..|..|.|.|::|||:|:||:.|.......|.|..:|.||...|:.:||:.:..|||||.::|
Mouse   120 TLIKLALPHLRKSRGNIINISSLVGAIGQSQALTYVATKGAVTAMTKALALDESRHGVRVNCISP 184

  Fly   186 GVIITEL-QRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDG 249
            |.|.|.| :.......:.....|| ..:...|||.|:..|||||..|||| ||:|.||:.|.|.|
Mouse   185 GNIWTPLWEELAASTSDPRATILE-GTLAQPLGRMGQPAEVAAAAVFLAS-EATFCTGLELLVTG 247

  Fly   250 G 250
            |
Mouse   248 G 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 94/261 (36%)
NADB_Rossmann 4..254 CDD:304358 94/261 (36%)
Hsd17b14NP_079606.3 NADB_Rossmann 1..256 CDD:304358 94/261 (36%)
fabG 8..251 CDD:235546 94/260 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 131 1.000 Domainoid score I5109
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4415
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm42920
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.