DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and hsd17b8

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001016671.1 Gene:hsd17b8 / 549425 XenbaseID:XB-GENE-490296 Length:255 Species:Xenopus tropicalis


Alignment Length:254 Identity:76/254 - (29%)
Similarity:122/254 - (48%) Gaps:17/254 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIV-AAGGAPALQVAADINSE 68
            |..:.:|||..||||......|:..|..:.:|..::...|.|.:.:. ...|......|.|::..
 Frog     8 KSMLALVTGGGSGIGRAICQRLSVEGASVVVVDLDISSANATLQTLSHNLSGQEHAAFATDVSKA 72

  Fly    69 SDVQGIVSATLAKHGRIDV----LVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPE 129
            :.|..::...   .||..|    .:::|||.:...:...|.|.||.|:|.|::..:.:|..|...
 Frog    73 NHVNSLMQKI---QGRYSVPPRIAISSAGITKDEFLLRLSEESFDSVLNVNLKGPFLITQAVARA 134

  Fly   130 LIKT---KGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITE 191
            ::.:   .|:|:|:.|:.|.....|...|..|||.|:..|:..|.|||..|:|.|:|.||.|.|.
 Frog   135 IVASGEHGGSIINIGSIVGKVGNLGQSNYAASKAGVEGLTKTAAKELAKFGIRCNTVLPGFISTP 199

  Fly   192 LQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            :..:  :.|:...||....    .|||.|..:::|...||||||::.:.||.|:.|.||
 Frog   200 MTDK--VPQKVLDKFAGMV----PLGRLGYPEDIADVCAFLASDDSKYITGASIEVTGG 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 76/254 (30%)
NADB_Rossmann 4..254 CDD:304358 76/254 (30%)
hsd17b8NP_001016671.1 BKR_SDR_c 11..254 CDD:187594 75/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.