DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and HSD17B14

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_057330.2 Gene:HSD17B14 / 51171 HGNCID:23238 Length:270 Species:Homo sapiens


Alignment Length:251 Identity:92/251 - (36%)
Similarity:134/251 - (53%) Gaps:13/251 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSE 68
            :..||::|||...|||||........|..:.|    .|| :|:..:.:......|:.:..|:..|
Human     7 YAGKVVVVTGGGRGIGAGIVRAFVNSGARVVI----CDK-DESGGRALEQELPGAVFILCDVTQE 66

  Fly    69 SDVQGIVSATLAKHGRIDVLVNNAGILELGS-IENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK 132
            .||:.:||.|:.:.||:|.:|||||...... .|.||.:.|.:::..|:...|.||.|..|.|.|
Human    67 DDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRK 131

  Fly   133 TKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITEL-QRRG 196
            ::||::|:||:.|.......:.|..:|.||...|:.:||:.:|.|||||.::||.|.|.| :...
Human   132 SQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELA 196

  Fly   197 GL--DQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            .|  |..|.::   ...:...|||.|:..||.||..|||| ||:|.|||.|.|.||
Human   197 ALMPDPRATIR---EGMLAQPLGRMGQPAEVGAAAVFLAS-EANFCTGIELLVTGG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 92/251 (37%)
NADB_Rossmann 4..254 CDD:304358 92/251 (37%)
HSD17B14NP_057330.2 RDH_SDR_c 1..256 CDD:187638 92/251 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5306
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4508
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.