DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and hsdl2

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001008673.1 Gene:hsdl2 / 493329 XenbaseID:XB-GENE-5753362 Length:417 Species:Xenopus tropicalis


Alignment Length:211 Identity:63/211 - (29%)
Similarity:105/211 - (49%) Gaps:24/211 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLD---KLNET----AEQIVAAGGAPALQVAADIN 66
            :.:||||.|||...::..|:.|..:.|..:..:   ||..|    |.:|.|||| .||....|:.
 Frog    13 LFITGASRGIGKAIALKAARDGANVVIAAKTAEAHPKLPGTIYTAASEIEAAGG-KALPCIVDVR 76

  Fly    67 SESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELI 131
            .|:.:...|...:...|.||:|||||..:.|.:...|.:::.|.:|..|.|..|..:.:..|.|.
 Frog    77 DENQISAAVEKAVDTFGGIDILVNNASAISLTNTLETPMKKVDLMMGINTRGTYLTSKICIPYLK 141

  Fly   132 KTK-GNIVNVS---SVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAP--KG-VRVNSVNPGVII 189
            |:| .:|:|:|   ::|.| .|....||.::|..:   :.| ||.::.  || :.||::.|...|
 Frog   142 KSKVAHILNLSPPLNLNPI-WFKNHCAYTIAKYGM---SMC-ALGMSEEYKGEIAVNALWPKTAI 201

  Fly   190 ----TELQRRGGLDQE 201
                .::....|:|::
 Frog   202 HTAAMDMLGGSGVDKQ 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 63/211 (30%)
NADB_Rossmann 4..254 CDD:304358 63/211 (30%)
hsdl2NP_001008673.1 HSDL2_SDR_c 8..248 CDD:187663 63/211 (30%)
SCP2 313..410 CDD:376720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.