DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and hsd17b14

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001003521.1 Gene:hsd17b14 / 445127 ZFINID:ZDB-GENE-040801-24 Length:271 Species:Danio rerio


Alignment Length:252 Identity:75/252 - (29%)
Similarity:128/252 - (50%) Gaps:4/252 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PSFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLD-KLNETAEQIVAAGGAPALQ-VAAD 64
            |.:::||:||||.:.|||.|......:.|..:.......: ...::.|.::...|..:.: |:.|
Zfish     5 PRYQNKVVIVTGGTRGIGRGIVKTFVQNGSKVVFCAPQTEMSAGQSLESVLNKEGPGSCKFVSCD 69

  Fly    65 INSESDVQGIVSATLAKHGRIDVLVNNAG-ILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTP 128
            :..|.|::.:::.|:...|:||.||||.| .....:.:.||.|:|..::|.|:.|.:..:....|
Zfish    70 MREEEDIKQLINVTVESFGQIDCLVNNVGWHPPHKTTDETSGEEFKDLLNLNLISFFLASKYALP 134

  Fly   129 ELIKTKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQ 193
            .|.||:|||:|:||:...........|..:|.|:...|:.:|::.:...||||.::|..|:|.|.
Zfish   135 YLRKTQGNIINLSSLVASIGQKDAAPYVATKGAITAMTKAMAVDESRYQVRVNCISPSNIMTPLW 199

  Fly   194 RRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            .....:.|.....::..:....:||.|...|...|..|||:| |:|.|||.|.:.||
Zfish   200 EELAANTEDTAATIKGGEDAQLIGRMGTEAESGLAALFLAAD-ATFCTGIDLFLSGG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 75/252 (30%)
NADB_Rossmann 4..254 CDD:304358 74/250 (30%)
hsd17b14NP_001003521.1 RDH_SDR_c 1..263 CDD:187638 75/252 (30%)
adh_short 26..205 CDD:278532 46/178 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.