DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and decr1

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001002444.2 Gene:decr1 / 436717 ZFINID:ZDB-GENE-040718-142 Length:333 Species:Danio rerio


Alignment Length:257 Identity:69/257 - (26%)
Similarity:121/257 - (47%) Gaps:15/257 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINS 67
            :||:||..:||..:|:|...:..|:.||....|..|:||.|.:||::|....|.....:..::..
Zfish    54 TFKNKVAFITGGGTGLGKAMTTTLSSLGAECVIASRSLDVLQKTADEISQQTGNKVHAIRCNVRD 118

  Fly    68 ESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK 132
            .:.|:..|...:...|..||::|||....:...|..|...:..:....:.....:|..:...|||
Zfish   119 PASVEAAVDQLVKDVGLPDVVINNAAGNFISPSEKLSPNAWKTITEIVLNGNAYVTLDIGKRLIK 183

  Fly   133 T-KG-NIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITE---- 191
            . || ..::::::........|:....:|:.|::....:|.|.:..|:|.|.:.||.|.|:    
Zfish   184 AEKGAAFLSITTIYAESGSGFVVPSAAAKSGVEKLCTSLAAEWSRYGMRFNVIQPGPIKTKGAFS 248

  Fly   192 -LQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGRH 252
             |...|..::    |.|:...|.. ||.|||:..:|   |:|.||.||:.:|..:.:|||.:
Zfish   249 RLDPAGVFEK----KILDRVAVGR-LGTPGEIANLA---AYLCSDYASWVSGAIIRMDGGEY 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 68/254 (27%)
NADB_Rossmann 4..254 CDD:304358 69/256 (27%)
decr1NP_001002444.2 TER_DECR_SDR_a 55..301 CDD:187627 68/253 (27%)
PRK07677 57..302 CDD:181077 67/252 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.