DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and CG5590

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster


Alignment Length:260 Identity:67/260 - (25%)
Similarity:119/260 - (45%) Gaps:35/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLD---KLNET----AEQIVAAGGAPALQVAAD 64
            :.:.:||||.|||...::..|:.|..:.:..:..:   ||..|    ||:|..||| .|.....|
  Fly    10 RTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGG-KAYPCVVD 73

  Fly    65 INSESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPE 129
            :..|..|:..|.|.:||.|.||:::|||..:.|.:..:|.::::|.:.|.|.|..:.::.:..|.
  Fly    74 VRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRGTFLVSKVCLPY 138

  Fly   130 LIKTK-GNIVNVSSVNGIRS--FPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVII-- 189
            |.|:. .:|:|:|....::.  |...:||.::|..:......:|.|...:|:.||::.|...|  
  Fly   139 LKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVNALWPRTAIHT 203

  Fly   190 TELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAI----------AFLASDEASFSTGIS 244
            ..::...|.|...:.:            :|..:.:.|.||          .|...||...|.||:
  Fly   204 AAIEMLTGPDSAKWSR------------KPEIMADAAYAILTREPRQSTGQFFVDDEVLESAGIT 256

  Fly   245  244
              Fly   257  256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 67/260 (26%)
NADB_Rossmann 4..254 CDD:304358 67/260 (26%)
CG5590NP_651578.1 FabG 5..245 CDD:223959 62/247 (25%)
PRK08278 7..277 CDD:181349 67/260 (26%)
SCP2 317..406 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435110
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.