DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and decr2

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_005162937.1 Gene:decr2 / 406623 ZFINID:ZDB-GENE-040426-2612 Length:301 Species:Danio rerio


Alignment Length:253 Identity:87/253 - (34%)
Similarity:126/253 - (49%) Gaps:18/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESD 70
            |:|..:||..||||...:.:|.:.|....|..|||:|:::.|:::.:..|...|.:|.|:.....
Zfish    35 DQVAFITGGGSGIGFRIAEVLMRHGCDTVIASRNLEKISQAAKKLTSTTGRRCLPIAMDVRQPET 99

  Fly    71 VQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKTK- 134
            :...|..||...||:|:|:|||....|....:.|...|..||..:....:..:.::..:..|.. 
Zfish   100 ILAAVDETLKTFGRVDILINNAAGNFLCPATSLSFNAFKTVMEIDTMGTFNTSKVIYDKWFKDHG 164

  Fly   135 GNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVII-TELQRR-GG 197
            |:|||:|:..|.|.....:....:|||.|..||.:|:|..|.|||||:|.||.|. ||..|| ||
Zfish   165 GSIVNISATLGYRGQALQVHAGSAKAANDAMTRHLAVEWGPSGVRVNTVAPGPISGTEGYRRLGG 229

  Fly   198 LDQEAYVKFLEHAKVTHA-----LGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
                      .||:...|     |.|.|...|:|.|:.||||..:|:.||..|..|||
Zfish   230 ----------SHAETAGAFHSIPLQRAGNKTEMAHAVLFLASRASSYVTGSVLVADGG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 87/253 (34%)
NADB_Rossmann 4..254 CDD:304358 87/253 (34%)
decr2XP_005162937.1 PRK07576 33..283 CDD:236056 87/253 (34%)
TER_DECR_SDR_a 33..280 CDD:187627 87/253 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.