DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and CG8757

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster


Alignment Length:254 Identity:67/254 - (26%)
Similarity:112/254 - (44%) Gaps:46/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQ----- 60
            |..:.:||.:|:|||:||||..:  .|.:|..:.:||  |.:.:|..|::  ..|....|     
  Fly     1 MERWCNKVAVVSGASAGIGAACT--RALIGAGMIVVG--LARRHERVEKL--RSGLSLEQQSRLH 59

  Fly    61 -VAADINSESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTH 124
             :..||..|..|......|..:.|.:||||:||||:..|.:.       :|.....:||..:...
  Fly    60 AIKCDITQEDQVLKAFDWTCRQLGGVDVLVSNAGIIGTGELS-------ERDDGPAMRSTIETNI 117

  Fly   125 LVTPELIK----------TKGNIVNVSSVNGIR------SFPGVLAYNVSKAAVDQFTRCVALEL 173
            :.|...::          |:|::|.|:||.|.:      ..|.:..|..:|.|:.........|.
  Fly   118 MGTVYCVRESFRSMKRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEF 182

  Fly   174 A--PKGVRVNSVNPGVIITEL---QRRGGLDQEAYVKFLEHAKVTH----ALGRPGEVK 223
            .  ...|||::|:||::.|.:   |.:|.:.|  ::..|....|..    |:|.|..|:
  Fly   183 QRHKTAVRVSTVSPGIVDTVILPEQIQGIIKQ--HMPMLRSDDVADAVLWAIGTPPNVQ 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 66/253 (26%)
NADB_Rossmann 4..254 CDD:304358 66/251 (26%)
CG8757NP_648664.2 YdfG 1..252 CDD:226674 67/254 (26%)
NADB_Rossmann 1..247 CDD:304358 67/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.