DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and decr2

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_002932500.3 Gene:decr2 / 394884 XenbaseID:XB-GENE-5949565 Length:300 Species:Xenopus tropicalis


Alignment Length:254 Identity:87/254 - (34%)
Similarity:127/254 - (50%) Gaps:18/254 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSES 69
            |.:|..:||..||||...:.:..:.|....||.|||.:::|.||::..:.|...|.::.|:....
 Frog    33 KGRVAFITGGGSGIGFRIAEIFMRHGCDTIIVSRNLQRVSEAAEKLKVSTGQRCLPLSGDVRDAQ 97

  Fly    70 DVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKTK 134
            .:...|...|....|:|:|||||....|....:.||..|..|::.:....:..:.::.....:..
 Frog    98 SMNAAVEEALRIFSRVDILVNNAAGNFLCPASSLSLNAFKTVIDIDTVGTFNASKILFERFFRDN 162

  Fly   135 GN-IVNVSSVNGIRSFPG-VLAYNV--SKAAVDQFTRCVALELAPKGVRVNSVNPGVII-TE-LQ 193
            |. |||:::.   .||.| ||..:.  :|||||..||.:|:|..|..||||.:.||.:. || ::
 Frog   163 GGVIVNITAT---LSFRGQVLQVHAGSAKAAVDAMTRHLAVEWGPSRVRVNCLAPGPVSGTEGMR 224

  Fly   194 RRGGLDQEAYVKFLEHAKV--THALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            |.||...||       |.|  |..|.|.|...|:|....||||..|||.||.:|.:|||
 Frog   225 RLGGAAAEA-------AGVWATLPLQRIGNKTEIAHGALFLASPLASFVTGTTLVMDGG 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 87/254 (34%)
NADB_Rossmann 4..254 CDD:304358 87/254 (34%)
decr2XP_002932500.3 TER_DECR_SDR_a 32..279 CDD:187627 87/254 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.