DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and CG11200

DIOPT Version :10

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_611471.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster


Alignment Length:43 Identity:11/43 - (25%)
Similarity:22/43 - (51%) Gaps:13/43 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 PEKYAADGDAIQKAIDQAVQEAIEQNIASQSVTPFILARVNEL 285
            ||:.||:.:  |:.:|...:  ::.:|.:|         |||:
  Fly    92 PEELAAEAE--QEDLDDFTK--LKNSIETQ---------VNEI 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 Rossmann-fold NAD(P)(+)-binding proteins 4..254 CDD:473865 4/10 (40%)
CG11200NP_611471.1 Rossmann-fold NAD(P)(+)-binding proteins 67..338 CDD:473865 11/43 (26%)

Return to query results.
Submit another query.