DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and dhrs1

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001002205.1 Gene:dhrs1 / 368670 ZFINID:ZDB-GENE-030616-591 Length:310 Species:Danio rerio


Alignment Length:260 Identity:82/260 - (31%)
Similarity:124/260 - (47%) Gaps:44/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESDVQ 72
            :.:|||||.|||.|.::.|::.|..:.|.||....|.:||.::...||. .|.|..|.:.|.|::
Zfish     7 ICVVTGASRGIGRGIALQLSEAGATVYITGRQEKSLKQTAAEVAERGGR-CLPVVCDSSKEEDIK 70

  Fly    73 GIVS-ATLAKHGRIDVLVNN--AGILELGSIENTSLEQF--------DRVMNTNVR-----SLYQ 121
            .:.. ....::||:|:||||  ||:..:  ::|.| ::|        |.:.||.:|     |:|.
Zfish    71 ELFERVEREQNGRLDILVNNAYAGVQAI--LDNVS-KKFWEVDPGIWDTINNTGLRGHYFCSVYA 132

  Fly   122 LTHLVTPELIKTKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPG 186
            ...:|.    :.||.||.:||:.|:|....| .|.|.|||.|:....:.:||..:||...|:.||
Zfish   133 ARLMVA----QGKGLIVVISSMGGLRYLFNV-PYGVGKAACDRMAADMGIELKKRGVASVSLWPG 192

  Fly   187 VIITEL------QRRG--GLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFS-TG 242
            .:.||.      |..|  |.|.: |.....:.:.|...||         .|..||.|:...| ||
Zfish   193 AVQTETIKQYMSQDEGPPGFDSK-YKDVFTNGETTELSGR---------CIVELAKDKGLMSMTG 247

  Fly   243  242
            Zfish   248  247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 82/260 (32%)
NADB_Rossmann 4..254 CDD:304358 82/260 (32%)
dhrs1NP_001002205.1 PRK08303 1..267 CDD:236229 82/260 (32%)
DHRS1-like_SDR_c 3..268 CDD:187664 82/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.