DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and Hsd17b8

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_006256026.1 Gene:Hsd17b8 / 361802 RGDID:1303158 Length:273 Species:Rattus norvegicus


Alignment Length:254 Identity:77/254 - (30%)
Similarity:119/254 - (46%) Gaps:23/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQ----------VAADI 65
            ::||.||||...||.||..|.  .:...:||  ...|:..|...|.|..:          ..||:
  Rat    16 ISGAGSGIGRAISVRLAAEGA--AVAACDLD--GAAAQDTVRLLGNPGSEDREPRGKHAAFQADV 76

  Fly    66 NSESDVQGIVSATLAKHGR-IDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPE 129
            :.....:.::....|...| ..|:|:.|||.....:.:.|.|.:|||:..|::..:.:|......
  Rat    77 SEGPAAKRLLEQVQACFFRPPSVVVSCAGITRDEFLLHMSEEDWDRVIAVNLKGTFLVTQAAAQA 141

  Fly   130 LIKT--KGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITEL 192
            |:.:  :|:|:|:||:.|.....|...|..|||.|...|:..|.||...|:|.|||.||.|.|. 
  Rat   142 LVSSGGRGSIINISSIVGKVGNIGQTNYASSKAGVIGLTQTAARELGRHGIRCNSVLPGFIATP- 205

  Fly   193 QRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGR 251
                 :.|:...|..:.......||..|:.::||..:|||||:::.:.||.|:.|.|.|
  Rat   206 -----MTQKMPEKVKDKVTAMIPLGHMGDPEDVADVVAFLASEDSGYITGASVEVSGMR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 76/252 (30%)
NADB_Rossmann 4..254 CDD:304358 77/254 (30%)
Hsd17b8XP_006256026.1 BKR_SDR_c 16..257 CDD:187594 75/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.