DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and Hsdl1

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001020067.1 Gene:Hsdl1 / 361418 RGDID:1308433 Length:330 Species:Rattus norvegicus


Alignment Length:193 Identity:50/193 - (25%)
Similarity:95/193 - (49%) Gaps:10/193 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESDVQGI 74
            :::||:.|||...:..||..|..:.::.:..:||...|:.|........|.:.||.:...::...
  Rat    71 VISGATDGIGKAYAEELASHGLNIILISQEEEKLQAVAKHIADTYRVETLVLVADFSRGREIYAP 135

  Fly    75 VSATLAKHGRIDVLVNNAGIL-----ELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELI-KT 133
            :...| :...|.:|||:.|..     ....:...::  :| ::|.|:.:...:.|:|.|.:: :.
  Rat   136 IREAL-RDRDIGILVNDVGAFYPYPQYFSQVPEDTI--WD-IVNVNIAAASLMVHIVLPGMVERK 196

  Fly   134 KGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRG 196
            ||.||.|||.:..:..|.:.|::.|||.:|.|:|.:..|.|.||:.|.|:.|..:.:.:...|
  Rat   197 KGAIVTVSSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYASKGIFVQSLIPFYVTSSVTAPG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 50/193 (26%)
NADB_Rossmann 4..254 CDD:304358 50/193 (26%)
Hsdl1NP_001020067.1 Required for mitochondria translocation. /evidence=ECO:0000250 2..82 5/10 (50%)
17beta-HSD1_like_SDR_c 67..309 CDD:187614 50/193 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.