DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and CG13284

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001260523.1 Gene:CG13284 / 35021 FlyBaseID:FBgn0032614 Length:339 Species:Drosophila melanogaster


Alignment Length:223 Identity:65/223 - (29%)
Similarity:106/223 - (47%) Gaps:16/223 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESDVQGI 74
            :||||:.|||...:..||:.|..|.::.|..:||.....:|.:........:|||.....:|...
  Fly    74 VVTGATDGIGKEYARELARQGINLVLISRTKEKLIAVTNEIESQYKVKTKWIAADFAKGREVYDQ 138

  Fly    75 VSATLAKHGRIDV--LVNNAGIL--ELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELI-KTK 134
            :...||   .|||  ||||.|::  ...|::..|.:....::..|:.|:..||..:.|::| :.|
  Fly   139 IEKELA---GIDVGILVNNVGMMYEHPESLDLVSEDLLWNLLTVNMGSVTMLTRKILPQMIGRRK 200

  Fly   135 GNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQ------ 193
            |.|||:.|.:.::..|.:..|..||..|..|::.:.||:|...:.|..|.|..::|::.      
  Fly   201 GAIVNLGSSSELQPLPNMTVYAASKKFVTYFSKALELEVAEHNIHVQLVMPNFVVTKMNAYTDRV 265

  Fly   194 RRGGLDQEAYVKFLEHAKVTHALGRPGE 221
            .:|||.......|...|..|  ||:..|
  Fly   266 MQGGLFFPNAYTFARSAVFT--LGKTSE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 65/223 (29%)
NADB_Rossmann 4..254 CDD:304358 65/223 (29%)
CG13284NP_001260523.1 DltE 70..323 CDD:223377 65/223 (29%)
17beta-HSD1_like_SDR_c 70..309 CDD:187614 65/223 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.