DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and CG7322

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001259693.1 Gene:CG7322 / 32880 FlyBaseID:FBgn0030968 Length:242 Species:Drosophila melanogaster


Alignment Length:244 Identity:87/244 - (35%)
Similarity:131/244 - (53%) Gaps:13/244 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESDV 71
            |||:||||.:|||......||..|..:..|.|..::|    :|:||........:..|::....|
  Fly     8 KVILVTGAGAGIGQALVKQLASAGATVIAVARKPEQL----QQLVAFDPVHIQPLQLDLSGWQAV 68

  Fly    72 QGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKTKGN 136
            :    ..|||...:|.||||||:..:...|..:.:.||...:.|:::::.:|..:.|.| |...:
  Fly    69 R----EGLAKVPLLDGLVNNAGVAIIKPFEELTEQDFDTHFDVNIKAVFNVTQSLLPRL-KDGAS 128

  Fly   137 IVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGGLDQE 201
            ||||||:...|||.|..||:.:|||:|..|:.:||||.|:.:|||||||.|::|::......|..
  Fly   129 IVNVSSIASSRSFGGHTAYSATKAALDSLTKSLALELGPRKIRVNSVNPTVVLTKMGADNWSDPA 193

  Fly   202 AYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            .....|.|.    .|.|..||:||..|..:|.|.::||..|..:.::||
  Fly   194 KSGPLLAHI----PLNRFCEVQEVVDATGYLLSSKSSFVNGHHILLEGG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 87/244 (36%)
NADB_Rossmann 4..254 CDD:304358 87/244 (36%)
CG7322NP_001259693.1 XR_like_SDR_c 1..242 CDD:187609 87/244 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I1866
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I1506
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.