DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and hsdl2

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_955893.1 Gene:hsdl2 / 322347 ZFINID:ZDB-GENE-030131-1066 Length:415 Species:Danio rerio


Alignment Length:248 Identity:73/248 - (29%)
Similarity:116/248 - (46%) Gaps:34/248 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLD---KLNET----AEQIVAAGGAPALQVAADIN 66
            |.:||||.|||...::..|:.|..:.|..:..|   ||..|    |.:|.|||| .||....|:.
Zfish    13 IFITGASRGIGKAIALKAAQDGANVVIAAKTADPHPKLPGTIYTAAAEIEAAGG-KALPCIVDVR 76

  Fly    67 SESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELI 131
            .|..:...|...:.|.|.||:|||||..:.|.....|.:::.|.::..|:|..|..:.|..|.|:
Zfish    77 DEKQINDAVEQAVEKFGGIDILVNNASAINLTGTLQTPMKKADLMLGINLRGTYLTSKLCIPHLL 141

  Fly   132 KTKG-NIVNVS---SVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPK---GVRVNSVNPGVII 189
            |:|. :|:|:|   ::|.| .|....||.::|..:   :.|| |.:|.:   .:.||::.|...|
Zfish   142 KSKNPHILNLSPPLNLNPI-WFKNHTAYTIAKYGM---SMCV-LGMAEEFRGSIAVNALWPKTAI 201

  Fly   190 TELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTG 242
                      |.|.:..|..::|    |:.....|:.|..|:....:.:..||
Zfish   202 ----------QTAAMDMLGGSEV----GKQCRKVEIMADAAYAIFKQPTSFTG 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 73/248 (29%)
NADB_Rossmann 4..254 CDD:304358 73/248 (29%)
hsdl2NP_955893.1 HSDL2_SDR_c 8..248 CDD:187663 73/248 (29%)
adh_short 12..210 CDD:278532 65/212 (31%)
SCP2 311..408 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.