DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and CG31810

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster


Alignment Length:207 Identity:64/207 - (30%)
Similarity:100/207 - (48%) Gaps:29/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKL----NETAEQI------VAAGGAPALQVAAD 64
            :||||:.|||...:..||:.|..|.:|.|..:||    ||...|.      :.|..|...:|.|.
  Fly    60 VVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAH 124

  Fly    65 INSESDVQGIVSATLAKHGRIDVLVNNAG-ILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTP 128
            |  |.::.||         .:.:||||.| |.:..|::..|.:....::..||.|:..||..:.|
  Fly   125 I--EKELNGI---------EVGILVNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILP 178

  Fly   129 ELI-KTKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITEL 192
            ::| :.||.|||:.|.:.::..|.:.||..:|..|..||:.:..|:|...:.|..|.|..:.|.:
  Fly   179 QMISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNM 243

  Fly   193 Q------RRGGL 198
            .      |:|||
  Fly   244 NSYSDKVRQGGL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 64/207 (31%)
NADB_Rossmann 4..254 CDD:304358 64/207 (31%)
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 64/207 (31%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 64/207 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.