DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and CG10962

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster


Alignment Length:250 Identity:66/250 - (26%)
Similarity:112/250 - (44%) Gaps:36/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVG--RNLDKLNETAEQIVAAGGAPALQVAA 63
            |..::::|.:::||||||||..:.||...|  |.:||  |..|:|.:..:.:.|.......|...
  Fly     1 MDRWQNRVAVISGASSGIGAACARLLVAAG--LQVVGLARRTDRLEQLRQSLPAEQRMRFHQHKC 63

  Fly    64 DINSESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTP 128
            |::.|..|.........:.|.||||:|||||:..|.:.:...:..:.::.||:......|.|...
  Fly    64 DVSQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAAS 128

  Fly   129 ELIKTK--GNIVNVSSVNGIRSF------PGVLAYNVSKAAVDQFTRCVALELAPKG--VRVNSV 183
            .:.:.:  |:::.|:|..|:..:      ..:.||..||.|:.........||..:|  ::..|:
  Fly   129 SMRRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTSI 193

  Fly   184 NPGVIITELQRRGGLDQEAYVKFLEHAKVTHALGRPGEV----KEVAAAIAFLAS 234
            |||.:.||:     :..|...|.             |||    .:||.|:.:..|
  Fly   194 NPGWVATEI-----VPDETKAKL-------------GEVILQADDVAQAVLYALS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 64/248 (26%)
NADB_Rossmann 4..254 CDD:304358 64/246 (26%)
CG10962NP_788887.1 YdfG 1..249 CDD:226674 65/249 (26%)
NADB_Rossmann 1..243 CDD:304358 65/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435088
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.