DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and sni

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster


Alignment Length:216 Identity:54/216 - (25%)
Similarity:95/216 - (43%) Gaps:38/216 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IIVTGASSGIGAGTSVLLAKL----GGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINS-- 67
            |::||.:.|:|.|....|..|    ..|.|.. ||.::..|..:..........|::  |:.:  
  Fly     4 ILITGCNRGLGLGLVKALLNLPQPPQHLFTTC-RNREQAKELEDLAKNHSNIHILEI--DLRNFD 65

  Fly    68 -----ESDVQGIVSATLAKHGRIDVLVNNAGIL-ELGSIENTSLEQFDRVMNTNVRSLYQLTHLV 126
                 .:|::|:     .|...::||.|||||. :...|.....::....:.||......|....
  Fly    66 AYDKLVADIEGV-----TKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKAC 125

  Fly   127 TPELIK-TKGN-----------IVNVSSVNGI---RSFPGVLAYNVSKAAVDQFTRCVALELAPK 176
            .|.|.| .|.|           |:|:||:.|.   .:..|:.||..||:|::..|:.::::|.|:
  Fly   126 LPLLKKAAKANESQPMGVGRAAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLYPQ 190

  Fly   177 GVRVNSVNPGVIITELQRRGG 197
            .:...|::||.:.|::   ||
  Fly   191 RIMCVSLHPGWVKTDM---GG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 54/216 (25%)
NADB_Rossmann 4..254 CDD:304358 54/216 (25%)
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 54/216 (25%)
adh_short 4..209 CDD:278532 54/216 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435119
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.