DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and CG3603

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster


Alignment Length:250 Identity:85/250 - (34%)
Similarity:126/250 - (50%) Gaps:17/250 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESDV 71
            ||.:||||.||||..|..|||:.|..:..|.|||....||.:::.:...| ||:|  |::|...|
  Fly     9 KVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSERSA-ALEV--DVSSAQSV 70

  Fly    72 QGIVSATLAKHGRI-DVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKTK- 134
            |..|:..|.|..:. .::||:|||...|.:.......:|.|...|::..:.:|......:|:.| 
  Fly    71 QFSVAEALKKFQQAPTIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMIEQKL 135

  Fly   135 --GNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQR--R 195
              |.|||:||:....:..|...|..:||.|..||...:.|....|:|||.:.||.|.|.:..  .
  Fly   136 ENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEFGKFGIRVNCILPGYIDTPMVAVVP 200

  Fly   196 GGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            ..:.||...:.        .|||.|:.:|:|..||||||.::|:..|.::.|.||
  Fly   201 DSVKQEVVQRC--------PLGRLGQPEEIAEVIAFLASPQSSYVNGAAIEVTGG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 84/249 (34%)
NADB_Rossmann 4..254 CDD:304358 84/249 (34%)
CG3603NP_001259199.1 fabG 6..248 CDD:235546 84/249 (34%)
BKR_SDR_c 9..248 CDD:187594 84/249 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.