DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and CG13377

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001259089.1 Gene:CG13377 / 30972 FlyBaseID:FBgn0261446 Length:330 Species:Drosophila melanogaster


Alignment Length:205 Identity:49/205 - (23%)
Similarity:90/205 - (43%) Gaps:37/205 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLG--------------------GLLTIVGRNLDKLNETA 47
            |...:|:::|.|.:.:|......||..|                    |.:        |:.|.:
  Fly    42 SHPSRVVLITSADTALGLQLCTHLANKGYRVFAGMKEAQDSLPAKLLCGWM--------KIREYS 98

  Fly    48 EQIVAAGGAP-ALQVA-ADINSESDVQGIVSATL-AKHGRIDVLVNNAGILELGSIENTSLEQFD 109
            |:.:|....| .|.|. .|:..|:.|  |:.|.| |....|..::|.:|.:..|.:|:.:::|::
  Fly    99 EEPIAGTIIPMRLDVTREDVLREATV--IIGANLNADERGIAAVINTSGSVFRGQVESQNVQQWE 161

  Fly   110 RVMNTNVRSLYQLTHLVTPELIKTKGNIVNVSSVNG----IRSFPGVLAYNVSKAAVDQFTRCVA 170
            .::.||:....::.......|..|:|.::.:..|:|    .....|::|:|.|:.|||:....:.
  Fly   162 HMLRTNILGTLRVAKAFVCFLRPTRGRLLYLGGVSGGGNARNEGDGLVAFNASRVAVDKCAEELR 226

  Fly   171 LELAPKGVRV 180
            .||.|.||.|
  Fly   227 KELHPYGVSV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 49/205 (24%)
NADB_Rossmann 4..254 CDD:304358 48/204 (24%)
CG13377NP_001259089.1 adh_short 46..246 CDD:278532 48/201 (24%)
NADB_Rossmann 46..>237 CDD:304358 48/201 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435077
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.