DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and Cbr3

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001100580.1 Gene:Cbr3 / 304078 RGDID:1309728 Length:277 Species:Rattus norvegicus


Alignment Length:240 Identity:62/240 - (25%)
Similarity:100/240 - (41%) Gaps:54/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVIIVTGASSGIG-AGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESD 70
            :|.:||||:.||| |.|..|..|..|.:.:..|:..:.....:|:.|.|.:|... ..||::...
  Rat     6 RVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVKQLQAEGLSPRFH-QLDIDNPQS 69

  Fly    71 VQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELI---K 132
            ::.:......::|.::||||||||    :........||......:::.:..|..|..||:   |
  Rat    70 IRALRDFLRKEYGGLNVLVNNAGI----AFRMDDPTPFDVQAEVTLKTNFFATRNVCTELLPIMK 130

  Fly   133 TKGNIVNVSSVNGIRSF-----------------PGVL------------------------AYN 156
            ..|.:|||||:.|:::.                 .|.|                        ||.
  Rat   131 PHGRVVNVSSLQGLKALENCSEDLQERFRCDTLTEGDLVDLMKKFVEDTKNEVHEREGWPDSAYG 195

  Fly   157 VSKAAVDQFTRCVALELAPK----GVRVNSVNPGVIITELQRRGG 197
            |||..|...||.:|.:|..|    .:.:|:..||.:.|::.|..|
  Rat   196 VSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMARDQG 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 62/240 (26%)
NADB_Rossmann 4..254 CDD:304358 62/240 (26%)
Cbr3NP_001100580.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 62/240 (26%)
adh_short 6..241 CDD:278532 62/240 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.