DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and Bdh2

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001099943.1 Gene:Bdh2 / 295458 RGDID:1309898 Length:255 Species:Rattus norvegicus


Alignment Length:258 Identity:83/258 - (32%)
Similarity:128/258 - (49%) Gaps:24/258 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQV-AAD 64
            |...:.|||::|.|:.|||..:::..|:.|..:.....|..||.|....       |.:|. ..|
  Rat    11 MGRLEGKVIVLTAAAQGIGRASALAFAREGAKVIATDINEAKLQELENY-------PGIQTRVLD 68

  Fly    65 INSESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPE 129
            :..:..:....|    :..:||||.|.||.:..|:|.:...:.:|..||.||||:|.:.....|:
  Rat    69 VTKKRQIDQFAS----EIEKIDVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMYLMIKAFLPK 129

  Fly   130 LIKTK-GNIVNVSSV-NGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIIT-- 190
            ::..| |||:|:||| :.|:.......|:.:||||...|:.||.:...:|:|.|.|.||.:.|  
  Rat   130 MLAQKSGNIINMSSVASSIKGVENRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPS 194

  Fly   191 ---ELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
               .:|.|.. .:||...||...|.    ||....:|||....:|||||:::.||..:.:|||
  Rat   195 LQERIQARDD-PKEALKAFLNRQKT----GRFASAEEVALLCVYLASDESAYVTGTPVVIDGG 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 82/257 (32%)
NADB_Rossmann 4..254 CDD:304358 82/255 (32%)
Bdh2NP_001099943.1 PRK06138 12..254 CDD:235712 82/257 (32%)
DHRS6_like_SDR_c 15..255 CDD:187626 82/254 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.