DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and Dhrs4

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001033027.2 Gene:Dhrs4 / 28200 MGIID:90169 Length:279 Species:Mus musculus


Alignment Length:252 Identity:79/252 - (31%)
Similarity:135/252 - (53%) Gaps:17/252 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGR---NLDKLNETAEQIVAAGGAPALQVAADINS 67
            :||.:||.::.|||...:..||:.|..:.:..|   |:|:...|.:    ..|.....:...:..
Mouse    33 NKVALVTASTDGIGFAIARRLAEDGAHVVVSSRKQQNVDRAVATLQ----GEGLSVTGIVCHVGK 93

  Fly    68 ESDVQGIVSATLAKHGRIDVLVNNAGILE-LGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELI 131
            ..|.:.:::..|.:|..||:||:||.:.. .|::.:.:.|.:|:|::.||.:...:...|.||:.
Mouse    94 AEDREKLITTALKRHQGIDILVSNAAVNPFFGNLMDVTEEVWDKVLSINVTATAMMIKAVVPEME 158

  Fly   132 KT-KGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRR 195
            |. .|::|.|.||.|...||.:..|||||.|:...|:..|.|||||.:|||.:.||:|.|   |.
Mouse   159 KRGGGSVVIVGSVAGFTRFPSLGPYNVSKTALLGLTKNFAAELAPKNIRVNCLAPGLIKT---RF 220

  Fly   196 GGL--DQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            ..:  :::|...|::.|.....||:|   ::.|..::||.|::||:..|.::.|.||
Mouse   221 SSVLWEEKAREDFIKEAMQIRRLGKP---EDCAGIVSFLCSEDASYINGETVVVGGG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 79/252 (31%)
NADB_Rossmann 4..254 CDD:304358 79/252 (31%)
Dhrs4NP_001033027.2 CR_SDR_c 24..279 CDD:187641 79/252 (31%)
fabG 31..274 CDD:235975 77/250 (31%)
Microbody targeting signal 277..279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830563
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.