DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and DECR2

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_065715.1 Gene:DECR2 / 26063 HGNCID:2754 Length:292 Species:Homo sapiens


Alignment Length:252 Identity:81/252 - (32%)
Similarity:127/252 - (50%) Gaps:14/252 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSES 69
            :|||..:||..||||...:.:..:.|....|..|:|.::...|.::..|.|...|.::.|:.:..
Human    27 RDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPP 91

  Fly    70 DVQGIVSATLAKHGRIDVLVNNAG---ILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELI 131
            .|...|...|.:.||||:|:|.|.   :...|::   |...|..||:.:....:.::.::..:..
Human    92 AVMAAVDQALKEFGRIDILINCAAGNFLCPAGAL---SFNAFKTVMDIDTSGTFNVSRVLYEKFF 153

  Fly   132 KTKGN-IVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVII-TELQR 194
            :..|. |||:::..|.|.....:....:|||||..||.:|:|..|:.:||||:.||.|. ||..|
Human   154 RDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLR 218

  Fly   195 RGGLDQEAYVKFLEHAKVTHA-LGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            |.|..|.:.     ..|||.: |.|.|...|:|.::.:|||..||:.||..|..|||
Human   219 RLGGPQASL-----STKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 81/252 (32%)
NADB_Rossmann 4..254 CDD:304358 81/252 (32%)
DECR2NP_065715.1 TER_DECR_SDR_a 26..273 CDD:187627 81/252 (32%)
Substrate binding 126..128 1/1 (100%)
Microbody targeting signal. /evidence=ECO:0000250 290..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.