DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and SPAC4H3.08

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_594344.1 Gene:SPAC4H3.08 / 2543366 PomBaseID:SPAC4H3.08 Length:286 Species:Schizosaccharomyces pombe


Alignment Length:248 Identity:78/248 - (31%)
Similarity:118/248 - (47%) Gaps:11/248 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DKVIIVTGASSGIGAGTSVLLAKLGGLLTI--VGRNLDKLNETAEQIVAAGGAPALQVAADINSE 68
            :|..::||..||||...:|:.|:.|..|.|  :....|.. |....::...|.........::..
pombe    42 EKKTLLTGGDSGIGKAAAVMFAREGSDLVISCLPEERDDA-EVTRDLIEREGRNCWIWEGKLDKS 105

  Fly    69 SDVQGIVSATLAKHGRIDVLVNNAGILELG-SIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK 132
            .:.:.:|...|.|.|.|||||||....::. |||:...||:|....||:.|.:.:|......: |
pombe   106 DNCRDLVDFALKKLGWIDVLVNNIAYQQVAQSIEDIDDEQWDLTFKTNIFSFFWVTKAAISHM-K 169

  Fly   133 TKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGG 197
            :..:|||.||:|.....|.:|.|..:|.|:..|||.::.:.|..|:|||:|.||.|.|.|.    
pombe   170 SGSSIVNCSSINAYVGRPDLLDYTSTKGAITAFTRGLSNQYAQHGIRVNAVAPGPIYTPLV---- 230

  Fly   198 LDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
              ...:.|..........|||.|:..|||:...|||..:..:.||.:|..:||
pombe   231 --SSTFPKEKIELSDQVPLGRMGQPVEVASCYLFLACSDGGYMTGQTLHPNGG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 78/248 (31%)
NADB_Rossmann 4..254 CDD:304358 78/248 (31%)
SPAC4H3.08NP_594344.1 PRK06701 3..285 CDD:235853 78/248 (31%)
SDR_c1 13..285 CDD:187613 78/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 1 1.000 - - X68
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.