DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12171 and SPCC1739.08c

DIOPT Version :9

Sequence 1:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_588416.1 Gene:SPCC1739.08c / 2539211 PomBaseID:SPCC1739.08c Length:261 Species:Schizosaccharomyces pombe


Alignment Length:253 Identity:78/253 - (30%)
Similarity:126/253 - (49%) Gaps:18/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINS 67
            |.|.|..:|.||:.|||...:...|:.||.:.|.....|. .|.|:::....|.....:..||:.
pombe    18 SLKGKNCVVFGAAKGIGFSIATAFAQAGGNVIITYLTTDP-TEKAKKLAEETGVQVHTLKIDISR 81

  Fly    68 ESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK 132
            ...|:..|.........|.|:|.|||:....|:.::...:|::|||.|..|:|::.:.: .::.|
pombe    82 SDTVEAGVEEIQKIFKEIHVVVANAGMPFRRSVLDSPPHEFEKVMNINTNSVYRVAYYM-GKIFK 145

  Fly   133 TK--GNIVNVSSVNG--IRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQ 193
            .:  ||::..:|::.  :.:...:.||..|||||.|..:.:|:|.| :..|:|||:||...|::.
pombe   146 KQGFGNLIATASMSATIVNAPQHIAAYCASKAAVRQLCKALAVEWA-EFARINSVSPGYFATDMP 209

  Fly   194 RRGGLDQ-EAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            ....|.| |.||.|          .|.|...|:.....:|||:.:||.||:.|.||||
pombe   210 GYEFLKQWEPYVPF----------KRLGLTPELRGTYLYLASNASSFVTGLDLIVDGG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 78/253 (31%)
NADB_Rossmann 4..254 CDD:304358 77/252 (31%)
SPCC1739.08cNP_588416.1 PRK05867 13..260 CDD:135631 78/253 (31%)
MDH-like_SDR_c 14..260 CDD:187610 78/253 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101836
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.